Protein Info for RPSI07_RS19425 in Ralstonia solanacearum PSI07

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 636 PF00005: ABC_tran" amino acids 19 to 185 (167 residues), 81.2 bits, see alignment E=4.6e-26 amino acids 336 to 469 (134 residues), 85.2 bits, see alignment E=2.6e-27 PF12848: ABC_tran_Xtn" amino acids 224 to 297 (74 residues), 36.8 bits, see alignment E=1.4e-12 PF16326: ABC_tran_CTD" amino acids 561 to 629 (69 residues), 69.5 bits, see alignment E=9.2e-23

Best Hits

Swiss-Prot: 49% identical to UUP1_HAEIN: ABC transporter ATP-binding protein uup-1 (uup-A) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 100% identity to rsl:RPSI07_2424)

Predicted SEED Role

"COG0488: ATPase components of ABC transporters with duplicated ATPase domains" in subsystem Folate Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (636 amino acids)

>RPSI07_RS19425 ABC transporter ATP-binding protein (Ralstonia solanacearum PSI07)
MALFSITDAQLAFGHVALLDHTDFSLEAGERVGLIGRNGTGKSSLLKIVAGLAATDDGLI
ARQSGVTSAYVPQEPVFDPDQTVAEAVAMGVPQAAALLAEYEALVTSMGESHDEAALQRL
HMLQAQLEAADAWQLRTRVETTIAQLGLMPGARIGALSGGLTKRVALGQALVGAPDILML
DEPTNHLDYDSIRWLEDLLLAFRGSVLFITHDRAFLDRVATRIVELDRGKLRSYPGNFSA
YQMRKAQQLEAEALENARFDKLLAQEEVWIRKGVEARRTRSVGRVARLVQMREERAVRRE
VQGNVKLEVSQGDRSGKIVAELVDVTKCYGDKTVVRDFSATILRGDKVGLLGPNGVGKTT
LLKLILGELAPDTGTVRNGTNLQVAYFDQMRTQLDLNRSLADTISPGSDWVDINGQRKHV
MSYLGDFLFPPERARSPVASLSGGERNRLLLARLFARPANVLVLDEPTNDLDIDTLELLE
ELLQEYSGTVFLVSHDRAFVDNVVTSVIASESDGAWREYVGGFSDWQTQSARSAQLAQAA
KPVAEEKKAEPARTRERATVKLSYKEQRELDGLPARIEALEAEQKAVGAELEDGMIYGRD
PQRAQQLAERHEAIELELLDALERWETLEGKRAGTA