Protein Info for RPSI07_RS19230 in Ralstonia solanacearum PSI07

Annotation: ribokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 PF00294: PfkB" amino acids 13 to 305 (293 residues), 254.3 bits, see alignment E=1.7e-79 TIGR02152: ribokinase" amino acids 15 to 311 (297 residues), 382.6 bits, see alignment E=6.5e-119 PF08543: Phos_pyr_kin" amino acids 189 to 289 (101 residues), 33.5 bits, see alignment E=3e-12

Best Hits

Swiss-Prot: 42% identical to RBSK_SCHPO: Ribokinase (rbk1) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K00852, ribokinase [EC: 2.7.1.15] (inferred from 100% identity to rsl:RPSI07_2382)

Predicted SEED Role

"Ribokinase (EC 2.7.1.15)" in subsystem D-ribose utilization or Deoxyribose and Deoxynucleoside Catabolism (EC 2.7.1.15)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (315 amino acids)

>RPSI07_RS19230 ribokinase (Ralstonia solanacearum PSI07)
MVAKRSVLSSTAADVLVVGSLNMDLVIRTPRLPYPGQTVAAPALETIPGGKGANQAVAAA
RLGGRVAMLGCVGDDPHGTALREGLRREGVDTAMVTAHAGAPTGIACVTVADSGQNTIVI
VAGANRQLTPAMIDAQQAAFERAKVIVCQLESPLDAVERALLLGQRLGKTVILNPAPAAG
PLPTPWLAACDYLIPNETEAALLTARPVDSPEAALAAADDLHAQGARHVIITLGARGIAY
VDATTRLLMPAHPAQAIDTTAAGDTFVGALATALAEGAAPAEAIQFGQAAAAVSVTRLGA
QPSIPFRSELASPVQ