Protein Info for RPSI07_RS19220 in Ralstonia solanacearum PSI07

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 transmembrane" amino acids 34 to 58 (25 residues), see Phobius details amino acids 78 to 104 (27 residues), see Phobius details amino acids 116 to 137 (22 residues), see Phobius details amino acids 143 to 161 (19 residues), see Phobius details amino acids 172 to 218 (47 residues), see Phobius details amino acids 239 to 257 (19 residues), see Phobius details amino acids 269 to 288 (20 residues), see Phobius details amino acids 296 to 315 (20 residues), see Phobius details amino acids 321 to 338 (18 residues), see Phobius details PF02653: BPD_transp_2" amino acids 70 to 332 (263 residues), 163.7 bits, see alignment E=2.6e-52

Best Hits

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 100% identity to rsl:RPSI07_2380)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (348 amino acids)

>RPSI07_RS19220 ABC transporter permease (Ralstonia solanacearum PSI07)
MRPDSALPPAGSPGPADTPESAARASRRAGRTALGMSLGAIGGLLAALAAMLILFGLLSD
TFFTMPTFTTIANEIPDLLVMAVGMTFVLMIGGIDLSVGSVLALSASMLSIAMTRFGWGM
VPAALLGVLAATAAGALTGTVTVHWGIPSFIVSLGVLEMARGLAYSLTASRTVYIGGAVE
WLANPIALGIAPSFLIAIAITVIGQVVLVRTVFGRYLVAIGTNEEAVRLAGVDPRPYKIA
VFALMGLLSGLAALFQVSRLEAADPNAGVGMELQVIAAVVIGGTSLMGGRGSVARTLFGV
LIISVLEAGLAQIGASEPTKRIITGAVIVAAVVMDTYRTRRNRVTTRQ