Protein Info for RPSI07_RS18935 in Ralstonia solanacearum PSI07

Annotation: excinuclease ABC subunit UvrC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 669 TIGR00194: excinuclease ABC subunit C" amino acids 40 to 316 (277 residues), 320.6 bits, see alignment E=1.1e-99 PF01541: GIY-YIG" amino acids 50 to 124 (75 residues), 33.2 bits, see alignment E=1.3e-11 PF02151: UVR" amino acids 235 to 267 (33 residues), 29.1 bits, see alignment (E = 1.6e-10) PF08459: UvrC_RNaseH_dom" amino acids 451 to 602 (152 residues), 153.2 bits, see alignment E=1.3e-48 PF14520: HHH_5" amino acids 617 to 668 (52 residues), 33.3 bits, see alignment 1.4e-11

Best Hits

Swiss-Prot: 98% identical to UVRC_RALSO: UvrABC system protein C (uvrC) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K03703, excinuclease ABC subunit C (inferred from 100% identity to rsl:RPSI07_2321)

Predicted SEED Role

"Excinuclease ABC subunit C" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (669 amino acids)

>RPSI07_RS18935 excinuclease ABC subunit UvrC (Ralstonia solanacearum PSI07)
MPSDPTPSDSPDVPGAPPPGAQTPPAPAVEPSEAAFDAKAHIARLPNLPGVYRYFDAQGS
VLYVGKARDLKKRVSSYFTKTLLSPRIAMMVAKIAHIETTVVRSEAEALLLENNLIKALA
PRYNILFRDDKSYPYLKLTQHAYPRMAYYRGATDRKHQYFGPFPSAHAVRESMQILQKVF
QLRTCEDTVFNNRTRPCLLHQIHRCTAPCVQAISQEDYARDVANAAGFLLGRQDEVMQTL
QDKMQRHAVALEFEQAAAVRDQIGALSTVLKRQSVEEVGQASDIDILAVAIKGGHACVNL
AMVRGGRHLGDKAYFPTHVEEGAAIVGVDVEADVPEGAETQPEPARDAERMARDILEAFV
AQHYLDQFVPPVLVVSHPIQAAGLIEALAVQAGRRVSVVRQPQGARRAWLEMAEKGAELS
LARRLSEQGSQQARTRALAETIGIDLEDLAALRVECFDISHTAGEATQASCVVFHSHAMQ
NGEYRRYNIQGITPGDDYAAMRQVLTRRYQKVVEQAAEDAPDMPHVVLIDGGKGQVEVAR
QVFEELGLDIGLLVGVAKGEGRKVGLETLVFADSRPSLELGQGSAALMLVAQIRDEAHRF
AITGMRAKRAKARNTSRLEEIEGIGAKRRQRLLARFGGLRGVMAASVEELATVEGISQTL
AEEIYRQLH