Protein Info for RPSI07_RS18495 in Ralstonia solanacearum PSI07
Annotation: PHP domain-containing protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 53% identical to 35NBP_CHRVO: 3',5'-nucleoside bisphosphate phosphatase (CV_1693) from Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)
KEGG orthology group: K07053, (no description) (inferred from 100% identity to rsl:RPSI07_2236)Predicted SEED Role
"COG0613, Predicted metal-dependent phosphoesterases (PHP family)"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (286 amino acids)
>RPSI07_RS18495 PHP domain-containing protein (Ralstonia solanacearum PSI07) MLKRSASAPINADLHCHSTVSDGLLAPREVAARAAAHGVTLWALTDHDEVGGQAAAREAA ELLGMDYLPGVEISVTWAGRTLHIVGLGIDPDNAALVQGLERTRSGRGARAEDMAEALGK LGIHGAYEGALSYAGNPDMISRTHFARFLVEHGHCRDIAEVFDRYLGDGKPGFVPHRWAR LADAIGWIRGAGGVAVMAHPGRYTLTLLEHDVLFDEFKGFGGEGVEVITGSHTPDQYAYY ADVARRYGLLASRGSDFHGPGEGRVELGELPPLPDNLTPVWSRWLS