Protein Info for RPSI07_RS18360 in Ralstonia solanacearum PSI07

Annotation: tRNA lysidine(34) synthetase TilS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 signal peptide" amino acids 1 to 43 (43 residues), see Phobius details TIGR02432: tRNA(Ile)-lysidine synthetase" amino acids 39 to 218 (180 residues), 169 bits, see alignment E=1.1e-53 PF01171: ATP_bind_3" amino acids 39 to 218 (180 residues), 186.1 bits, see alignment E=8.1e-59 PF09179: TilS" amino acids 266 to 333 (68 residues), 59.2 bits, see alignment E=5.9e-20 TIGR02433: tRNA(Ile)-lysidine synthetase, C-terminal domain" amino acids 392 to 438 (47 residues), 49.7 bits, see alignment 1.9e-17 PF11734: TilS_C" amino acids 392 to 463 (72 residues), 80.5 bits, see alignment E=7.1e-27

Best Hits

Swiss-Prot: 90% identical to TILS_RALSO: tRNA(Ile)-lysidine synthase (tilS) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K04075, tRNA(Ile)-lysidine synthase [EC: 6.3.4.-] (inferred from 100% identity to rsl:RPSI07_2207)

Predicted SEED Role

"tRNA(Ile)-lysidine synthetase (EC 6.3.4.19)" (EC 6.3.4.19)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.4.19

Use Curated BLAST to search for 6.3.4.- or 6.3.4.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (474 amino acids)

>RPSI07_RS18360 tRNA lysidine(34) synthetase TilS (Ralstonia solanacearum PSI07)
MASSRKPARTDPSALLIDKVAQRVAACAAFVVSGGAPTVAVALSGGRDSAALLHAAAAWR
DVAGAPVRLVALHVHHGLQADADAWEVACARMAAAVGAEFHVRRVRVSADAGRGIEEAAR
EARYAALDALCAEAGATLLLTAHHLDDQAETVLLQLLRGAGLDGLSAMPMARQRRVTLLR
PWLDVPRSDIDAYARAHALAWVEDPSNDDARYARNALRPLLAGMAGHFPAYRASLARSAA
HLAEAAALIEEVAQADLARIAPAGALALADLATLSGPRQRAVLRAWLAGAGLRAASSRRL
EDLRTQLLSARADGALCVRLSGAHVRRYRGQAWIEVAGQPEAGPAACPIAVAQFDPAQLE
VQRVDVAEWGGALVFSPAQAEGIDARILQAPLSLTARRGGERIVLRPGGPSRALKQAYQE
AGIPAWARARLPLLYAGDRLVFAAGLGLDRSAVATGPGWRIAWLPAGADALSAS