Protein Info for RPSI07_RS18140 in Ralstonia solanacearum PSI07

Annotation: RNA polymerase sigma factor RpoS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 TIGR02394: RNA polymerase sigma factor RpoS" amino acids 94 to 376 (283 residues), 453.8 bits, see alignment E=2.7e-140 PF00140: Sigma70_r1_2" amino acids 103 to 136 (34 residues), 30.1 bits, see alignment 7.9e-11 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 137 to 365 (229 residues), 118.9 bits, see alignment E=1.7e-38 PF04542: Sigma70_r2" amino acids 141 to 210 (70 residues), 78 bits, see alignment E=7.8e-26 PF04539: Sigma70_r3" amino acids 221 to 297 (77 residues), 49.3 bits, see alignment E=9e-17 PF04545: Sigma70_r4" amino acids 311 to 363 (53 residues), 59.6 bits, see alignment 3.5e-20

Best Hits

KEGG orthology group: K03087, RNA polymerase nonessential primary-like sigma factor (inferred from 100% identity to rsl:RPSI07_2170)

Predicted SEED Role

"RNA polymerase sigma factor RpoS" in subsystem Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (377 amino acids)

>RPSI07_RS18140 RNA polymerase sigma factor RpoS (Ralstonia solanacearum PSI07)
MPRQKAATSANPADETISAVDGPNAPNGRSGRRARGAAPAASDDIEVVDTLIDEMPAAEP
TDVADTADANDSADEPDEEDEDDEDAAPEEDFRTVLQAELAADTVQHYLNRISIKPLLTP
AEELHFSTLAKAGEFAARQVMIERNLRLVVSIAKGYLNRGVPLLDLIEEGNLGLMHAIEK
FDPERGFRFSTYATWWIRQSIERAIMNQARTVRLPVHVIRELNQVLRAKRHLEKSGIDGR
DASIEDIAHLLGKTTDEVQDVLSLNEHTTSLDTPFDLDPGTSLLDFLSDEHGASPDQEVA
HRELSQLMKSWLARLSDKHRYVVERRFGLNHIEPATLEELAAEMGLTRERVRQIQQEALV
KLKRHFASQGVRKDAVL