Protein Info for RPSI07_RS18110 in Ralstonia solanacearum PSI07

Annotation: type IV pilus biogenesis/stability protein PilW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR02521: type IV pilus biogenesis/stability protein PilW" amino acids 9 to 247 (239 residues), 282.3 bits, see alignment E=1.5e-88 PF13432: TPR_16" amino acids 47 to 110 (64 residues), 22.8 bits, see alignment E=7.5e-08 amino acids 159 to 209 (51 residues), 17 bits, see alignment 4.9e-06 PF07719: TPR_2" amino acids 79 to 110 (32 residues), 24 bits, see alignment 2.1e-08 PF13181: TPR_8" amino acids 79 to 110 (32 residues), 25.5 bits, see alignment 7e-09 amino acids 151 to 181 (31 residues), 19.5 bits, see alignment 5.9e-07 PF13174: TPR_6" amino acids 80 to 109 (30 residues), 13.4 bits, see alignment 7e-05 PF13176: TPR_7" amino acids 152 to 182 (31 residues), 14.5 bits, see alignment 2.3e-05

Best Hits

KEGG orthology group: K02656, type IV pilus assembly protein PilF (inferred from 100% identity to rsl:RPSI07_2164)

Predicted SEED Role

"Type IV pilus biogenesis protein PilF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (262 amino acids)

>RPSI07_RS18110 type IV pilus biogenesis/stability protein PilW (Ralstonia solanacearum PSI07)
MKRWSIAVSLVLTLAAAGCALPPPAQTQDVKTLSDQTDISRRAAIRLQLATQYLEAGQAA
TALDEIKNAIAIDPSVPGAYHIRALAYMNLGQHELADESFRRALATQPNDGDLLNNYGWF
LCSQGGKPDQGMAMLRQAIEVPAAGSPSKPWTNLGVCQMRQGDLDSAEKSLTRATYIDAN
NPLTNLTLAQLHYKRRDYARAMSFIERVNGRGNPTAESLWLGARIARRLGDVSQQNAWSA
QLQRRFPNAPEEAAFERGAWDD