Protein Info for RPSI07_RS17990 in Ralstonia solanacearum PSI07

Annotation: NAD-dependent dihydropyrimidine dehydrogenase subunit PreA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 PF01180: DHO_dh" amino acids 4 to 305 (302 residues), 107 bits, see alignment E=3.9e-34 TIGR01037: dihydroorotate dehydrogenase family protein" amino acids 4 to 320 (317 residues), 170.4 bits, see alignment E=2.4e-54 PF01207: Dus" amino acids 122 to 180 (59 residues), 24.3 bits, see alignment E=5.7e-09 PF14697: Fer4_21" amino acids 338 to 398 (61 residues), 84.9 bits, see alignment E=1.2e-27 PF13237: Fer4_10" amino acids 338 to 391 (54 residues), 24.7 bits, see alignment 6.5e-09 PF12838: Fer4_7" amino acids 344 to 392 (49 residues), 34.6 bits, see alignment 7.7e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to rsl:RPSI07_2141)

MetaCyc: 60% identical to (NADP)-dependent dihydropyrimidine dehydrogenase (Brevibacillus agri)
Dihydropyrimidine dehydrogenase (NADP(+)). [EC: 1.3.1.2]; 1.3.1.2 [EC: 1.3.1.2]

Predicted SEED Role

"Dihydropyrimidine dehydrogenase [NADP+] (EC 1.3.1.2)" in subsystem Pyrimidine utilization (EC 1.3.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (435 amino acids)

>RPSI07_RS17990 NAD-dependent dihydropyrimidine dehydrogenase subunit PreA (Ralstonia solanacearum PSI07)
MADLRCTIAGIKSPNPFWLASAPPTDKAYNVNRAFEAGWGGVVWKTLGLDPHVVNVSSRY
GAVQWNGQRIAGLNNIELITDRPLEVNLREIAQVKRDWPDRALIVSLMVPCNERDWKWIL
PMVEDTGADAVELNFGCPHGMSERGMGSAVGQVPEYVEMVTRWVKAGTRLPCLVKLTPNI
TDIRLGSRAAYKGGADGVSLINTINSIVAVDLDQMAPMPTVDGKGTHGGYCGPAVKPIAL
NMVAEIARDAQTPGLPISGIGGISTWRDAAEFMVLGAGSVQVCTAAMHYGFRIVSDLADG
LANWMDEKGYATLDDVRGKAVSNVTDWKYLNLKYDIKARIDQDRCIQCGLCHIACEDTSH
QAITREKDGKRHFEVIDAECVGCNLCMHVCPVEQCITMARVDAGGYANWTTHPNNPVRAG
AEVPEAGAGTPARAA