Protein Info for RPSI07_RS17765 in Ralstonia solanacearum PSI07

Annotation: dihydrolipoyl dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01350: dihydrolipoyl dehydrogenase
  • amino acids 4 to 478 (475 residues), 542.8 bits, E=3.3e-167
• PF07992: Pyr_redox_2
  • amino acids 5 to 340 (336 residues), 245 bits, E=4.7e-76
• PF00890: FAD_binding_2
  • amino acids 6 to 36 (31 residues), 21.2 bits, see alignment (E = 6.3e-08)
• PF01134: GIDA
  • amino acids 6 to 158 (153 residues), 32.1 bits, E=2.7e-11
• PF00070: Pyr_redox
  • amino acids 188 to 263 (76 residues), 60.6 bits, E=6.8e-20
• PF02852: Pyr_redox_dim
  • amino acids 359 to 468 (110 residues), 131.9 bits, E=4.7e-42

Best Hits

Swiss-Prot: 85% identical to DLDH_CUPNH: Dihydrolipoyl dehydrogenase (odhL) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K00382, dihydrolipoamide dehydrogenase [EC: 1.8.1.4] (inferred from 100% identity to rsl:RPSI07_2094)

MetaCyc: 49% identical to glycine cleavage system L protein 1 (Arabidopsis thaliana col)
GCVMULTI-RXN [EC: 1.4.1.27]

Predicted SEED Role

"Dihydrolipoamide dehydrogenase of 2-oxoglutarate dehydrogenase (EC 1.8.1.4)" in subsystem TCA Cycle (EC 1.8.1.4)

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• folate transformations III (E. coli) (8/9 steps found)
• folate transformations II (plants) (9/11 steps found)
• 2-oxoglutarate decarboxylation to succinyl-CoA (3/3 steps found)
• 2-oxoisovalerate decarboxylation to isobutanoyl-CoA (3/3 steps found)
• glycine biosynthesis II (3/3 steps found)
• glycine cleavage (3/3 steps found)
• glycine degradation (3/3 steps found)
• pyruvate decarboxylation to acetyl CoA I (3/3 steps found)
• folate transformations I (8/13 steps found)
• photorespiration I (5/9 steps found)
• photorespiration III (5/9 steps found)
• reductive glycine pathway of autotrophic CO₂ fixation (5/9 steps found)
• photorespiration II (5/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glycine, serine and threonine metabolism
• Glycolysis / Gluconeogenesis
• Pyruvate metabolism
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.4

Use Curated BLAST to search for 1.4.1.27 or 1.8.1.4

Protein Sequence (478 amino acids)

>RPSI07_RS17765 dihydrolipoyl dehydrogenase (Ralstonia solanacearum PSI07)
MSKEFDVLVIGAGPGGYIAAIRAGQLGLNVACCEDNPYDDPKGEPRLGGTCLNVGCIPSK
ALLASSEEFENVNHHLADHGITVEGAKVDVTKMLKRKDDIVGKMTKGIEFLFRKNKVTLL
KGHGKFVGKTDAGYQVEVSGKAGAEVVTAKHVIIATGSKARHLPGVPVDNVTIADNEGAL
KFGGVPKKLGVIGAGVIGLELGSVWRRLGSEVTILEALPSFLGAADESVAKEANKLLTKQ
GLNIKVGVQVGEIQSSDQGVKVNYTDAAGAAQVLECDKLIVSIGRVPNTDNLGLDAIGLA
ADQRGFIEVDDHCATKLPNLWAIGDVVRGPMLAHKAEDEGVAVAERIVGQKPHIDYNCIP
WVIYTYPEIAWVGKTEQQLKAEGRETKAGQFPFMANGRALGMGASDGFVKIIADAKTDEI
LGVHVVAANASDLIAEAVVAMEFKAAAEDIGRICHPHPSMSEVMREAALAVDKRQLNM