Protein Info for RPSI07_RS17395 in Ralstonia solanacearum PSI07

Annotation: sulfate ABC transporter permease subunit CysW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 transmembrane" amino acids 26 to 52 (27 residues), see Phobius details amino acids 74 to 99 (26 residues), see Phobius details amino acids 111 to 136 (26 residues), see Phobius details amino acids 151 to 171 (21 residues), see Phobius details amino acids 212 to 237 (26 residues), see Phobius details amino acids 257 to 277 (21 residues), see Phobius details TIGR00969: sulfate ABC transporter, permease protein" amino acids 26 to 284 (259 residues), 326.7 bits, see alignment E=1.2e-101 TIGR02140: sulfate ABC transporter, permease protein CysW" amino acids 27 to 286 (260 residues), 422.5 bits, see alignment E=6.5e-131 PF00528: BPD_transp_1" amino acids 90 to 285 (196 residues), 52.1 bits, see alignment E=3.5e-18

Best Hits

KEGG orthology group: K02047, sulfate transport system permease protein (inferred from 100% identity to rsl:RPSI07_2021)

Predicted SEED Role

"Sulfate transport system permease protein CysW" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (325 amino acids)

>RPSI07_RS17395 sulfate ABC transporter permease subunit CysW (Ralstonia solanacearum PSI07)
MAGTVSRQLGQAPVAARRGATAEAAWVRATLILVSFVFLALFLFVPLASVFYEALRKGLG
VYWEALVEPDALSAIYLTLSVAAIAVPLNVVFGVAAAWAIAKFEFRGKHLLLTLIDLPFS
VSPVIAGLIYVLLFGAQGWFGPYLSEHDFKVIFAVPGIVLATVFVTFPFVARELIPLMQA
QGSEEEEAAIVLGASGWQTFFRVTLPNIKWGLLYGVILCNARAMGEFGAVSVVSGHIRGL
TNTMPLHVEILYNEYNFAAAFAVASLLTLLALVTLALKTLVEWRSRRELADADAGVGEGP
GQRATPSSIPPTHVCVQSPLEGSAA