Protein Info for RPSI07_RS17080 in Ralstonia solanacearum PSI07

Annotation: di-trans,poly-cis-decaprenylcistransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 TIGR00055: di-trans,poly-cis-decaprenylcistransferase" amino acids 16 to 240 (225 residues), 279.9 bits, see alignment E=6.7e-88 PF01255: Prenyltransf" amino acids 22 to 240 (219 residues), 275.9 bits, see alignment E=1.2e-86

Best Hits

Swiss-Prot: 93% identical to ISPT_RALSO: Isoprenyl transferase (uppS) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K00806, undecaprenyl diphosphate synthase [EC: 2.5.1.31] (inferred from 100% identity to rsl:RPSI07_1954)

MetaCyc: 56% identical to ditrans,polycis-undecaprenyl-diphosphate synthase [(2E,6E)-farnesyl-diphosphate specific] (Escherichia coli K-12 substr. MG1655)
Di-trans,poly-cis-decaprenylcistransferase. [EC: 2.5.1.31]

Predicted SEED Role

"Undecaprenyl diphosphate synthase (EC 2.5.1.31)" (EC 2.5.1.31)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (258 amino acids)

>RPSI07_RS17080 di-trans,poly-cis-decaprenylcistransferase (Ralstonia solanacearum PSI07)
MHISSTLTVPDTVDTPRHVAIIMDGNGRWATERHLPRMAGHSRGLDAVRAAVEAAGNRGV
RYLTLFAFSSENWRRPAEEVSFLMKLFMTALRREVSKLHDSGIRLRVVGDLGAFSPRIQL
LIREAEAKTAANSGLTVTIAANYGGRWDILQAMRALVADQPDIAPEAITEEALSPYLSLA
YASEPDLFIRTGGEQRISNFLLWQLAYSELYFTERYWPDFDAAEMDRAFAWYRNRERRFG
RTSAQVEPSTAPALSAGA