Protein Info for RPSI07_RS16665 in Ralstonia solanacearum PSI07

Annotation: thiazolinyl imide reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 TIGR01761: thiazolinyl imide reductase" amino acids 9 to 372 (364 residues), 523.3 bits, see alignment E=2e-161 PF01408: GFO_IDH_MocA" amino acids 12 to 138 (127 residues), 77.4 bits, see alignment E=1.5e-25 PF21390: Irp3-like_C" amino acids 162 to 269 (108 residues), 124.2 bits, see alignment E=2.6e-40

Best Hits

KEGG orthology group: None (inferred from 100% identity to rsl:RPSI07_1873)

Predicted SEED Role

"iron aquisition yersiniabactin synthesis enzyme (Irp3)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (387 amino acids)

>RPSI07_RS16665 thiazolinyl imide reductase (Ralstonia solanacearum PSI07)
MHDMPTARETYNVLVCGTRFGEHYLAALNRAESLRATRPAHLPRYRLAGLLARGSERSRA
LAQRLGVPLFSTPDEVPAGIDIACVVVRSAIVGGDGSSLARALLERGMHVLQEHPVHPTD
IARMRELAARHGRRYHVNTFYPHLPAGQCFIDYARQSATRNRPAFVEITTSLQLLYSSLD
MVCRALGGEGTFACSEPLPLDTLPGRPGAPWPFRAIQGVICSVPFSLNLQTYLDPGDPDH
HSLVMHRIAIGGPEGHVLLASSYGPVIWSHPIYAPDYGRNDAQASYLLSPQALGASRFNR
QPTALTFGPAHGPSLREAVASDFPVAIHAALDELVEAASPVHAAPWWHAHGQAWLGIMRA
AGQPVLVEQPEPPPPHPDPETYLREHA