Protein Info for RPSI07_RS16530 in Ralstonia solanacearum PSI07

Annotation: 2-oxo acid dehydrogenase subunit E2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00364: Biotin_lipoyl
  • amino acids 4 to 74 (71 residues), 68.5 bits, E=5.4e-23
• PF02817: E3_binding
  • amino acids 117 to 152 (36 residues), 53.2 bits, 4.2e-18
• PF00198: 2-oxoacid_dh
  • amino acids 167 to 369 (203 residues), 171 bits, E=4.5e-54

Best Hits

KEGG orthology group: K00627, pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC: 2.3.1.12] (inferred from 100% identity to rsl:RPSI07_1839)

Predicted SEED Role

"Dihydrolipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex (EC 2.3.1.168)" in subsystem Isoleucine degradation or Leucine Degradation and HMG-CoA Metabolism or Valine degradation (EC 2.3.1.168)

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• 2-oxoisovalerate decarboxylation to isobutanoyl-CoA (3/3 steps found)
• pyruvate decarboxylation to acetyl CoA I (3/3 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glycolysis / Gluconeogenesis
• Pyruvate metabolism
• Valine, leucine and isoleucine degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.12 or 2.3.1.168

Protein Sequence (372 amino acids)

>RPSI07_RS16530 2-oxo acid dehydrogenase subunit E2 (Ralstonia solanacearum PSI07)
MIVFKLPDLGEGLQEAEIVQWHVKAGDTIEADQPLVSVETAKAIVEIPSPQAGRIARLFG
QPGDIVHLGAPLVAFEGAGGDEADAGTVVGQMQVGQQVVQEAPAVLAAAPGAAAGSIKAT
PAVRALARKLDVDLSMVTPSGPDGVITAADVERVAKVFAELGPPEVLRGVRRAMAQNMAR
AQSEVAAATVIDDADIHAWPPGTDVTIRLIRALVAGCRAEPELNAWFDGHAGRRHVLEKI
DLGIAVDLPDGLFVPVLRDVAHRDAADLRAGLDRMRADIKARKIPPEELRGNTITLSNFG
MIAGKYAAPVVVPPTVAILGAGRIHEQVVAAGGAPAVHRVLPLSLTFDHRVVTGGEAARF
LAAAIADLEAAR