Protein Info for RPSI07_RS16060 in Ralstonia solanacearum PSI07

Annotation: peroxiredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08534: Redoxin
  • amino acids 29 to 152 (124 residues), 50.7 bits, E=1.8e-17
• PF00578: AhpC-TSA
  • amino acids 30 to 143 (114 residues), 93.9 bits, E=7.4e-31

Best Hits

Swiss-Prot: 44% identical to YKUU_BACSU: Putative peroxiredoxin YkuU (ykuU) from Bacillus subtilis (strain 168)

KEGG orthology group: K03386, peroxiredoxin (alkyl hydroperoxide reductase subunit C) [EC: 1.11.1.15] (inferred from 100% identity to rsl:RPSI07_1739)

Predicted SEED Role

"Alkyl hydroperoxide reductase protein C (EC 1.6.4.-)" in subsystem Thioredoxin-disulfide reductase (EC 1.6.4.-)

KEGG Metabolic Maps

• Glutathione metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.15, 1.6.4.-

Use Curated BLAST to search for 1.11.1.15 or 1.6.4.-

Protein Sequence (182 amino acids)

>RPSI07_RS16060 peroxiredoxin (Ralstonia solanacearum PSI07)
MKTIGDKLEPFKVVGVKPGFNQHEENGESALEEITETSFPGKWKVIYFYPKDFTFVCPTE
IVAFAKLNQDFEDRDTVVLGGSTDNEFVKLAWRREHKDLNKLDQWSFADTTGALIDQLGV
REHEAGVALRATFIVDPDNVIQHVSVNNLNVGRNPDEVLRILDGLQTDELCPCNRAIGGT
TL