Protein Info for RPSI07_RS16000 in Ralstonia solanacearum PSI07

Annotation: polyhydroxyalkanoate synthesis repressor PhaR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 TIGR01848: polyhydroxyalkanoate synthesis repressor PhaR" amino acids 10 to 115 (106 residues), 154.8 bits, see alignment E=4.5e-50 PF07879: PHB_acc_N" amino acids 11 to 70 (60 residues), 108.4 bits, see alignment E=1.4e-35 PF05233: PHB_acc" amino acids 75 to 113 (39 residues), 66.6 bits, see alignment 1.7e-22 amino acids 126 to 165 (40 residues), 61.6 bits, see alignment 6e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to rsl:RPSI07_1727)

Predicted SEED Role

"PhbF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (184 amino acids)

>RPSI07_RS16000 polyhydroxyalkanoate synthesis repressor PhaR (Ralstonia solanacearum PSI07)
MATSKKGAERLIKKYPNRRLYDTQTSTYITLADVKQLVMETEEFRVVDAKSGEDLTRSIL
LQIILEEETGGVPMFSGSMLAQIIRFYGNAMQGMMGTYLEKNIQAFVDIQNKLAENSKDL
YSGSTFNPDMWSQFMNMQGPMMQGMMSNYIEQSKNLFVQMQEQMQSQAKNMFGTFPFNQP
PEKK