Protein Info for RPSI07_RS15945 in Ralstonia solanacearum PSI07

Annotation: RNA-binding transcriptional accessory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 779 PF09371: Tex_N" amino acids 13 to 200 (188 residues), 242.4 bits, see alignment E=9.7e-76 PF16921: Tex_YqgF" amino acids 334 to 464 (131 residues), 181.4 bits, see alignment E=3.1e-57 PF14635: HHH_7" amino acids 477 to 569 (93 residues), 28.1 bits, see alignment E=7.5e-10 PF12836: HHH_3" amino acids 504 to 568 (65 residues), 101.9 bits, see alignment E=6.1e-33 PF17674: HHH_9" amino acids 574 to 643 (70 residues), 77.9 bits, see alignment E=3e-25 PF00575: S1" amino acids 662 to 733 (72 residues), 74.9 bits, see alignment E=1.8e-24

Best Hits

Swiss-Prot: 65% identical to TEX_BORPE: Protein tex (tex) from Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)

KEGG orthology group: K06959, uncharacterized protein (inferred from 86% identity to cti:RALTA_A1342)

Predicted SEED Role

"Transcription accessory protein (S1 RNA-binding domain)" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (779 amino acids)

>RPSI07_RS15945 RNA-binding transcriptional accessory protein (Ralstonia solanacearum PSI07)
MTDSVLQKIVSRIAAELSVKPQQVAAAVQLLDEGATVPFIARYRKEATGNLDDTHLRNLE
ERLLYLRELEDRRAAILASIEEQGKLTDPLRAAIEAAETKQVLEDLYLPYKPKRRTRAQI
ARECGLEPLAQALLADPTLDPQAEAAKFVNGKPTAEGGVPDAKAALDGARDILSEQFGET
AALLGKLRDHLWSQGVVASTVVEGKETAEEEKFRDYYAYSEPIRNVPSHRALALFRGRNA
GVLFVKLGLGEEQDAMIPHPCETMIARHVGIENKGRAADKWLSDVCRWCWRVKVQPHLET
ELLTQLRESAEAEAIKIFGRNLHDLLLAAPAGPKAVMGVDPGIRTGCKVAVVDHTGKLLE
TATIYPHEPRRDWNGSLATLARLAKQHGVSLVSIGNGTASRETDKLVQDLMHNLAKSAPE
QKLTKIVVSEAGASVYSASELAAKEFPELDVSLRGAVSIARRLQDPLAELVKIDPKSIGV
GQYQHDVNQRELARALDAVVEDCVNAVGVDVNTASSALLARVSGLNSILAKNIVEYRDAN
GAFANREALKQVPRLGDKTFEQAAGFLRINNGDNPLDRSSVHPEAYPVVQRILECIKKGI
GDVLGNREALRGVTAQAFTDDKFGLPTVVDILGELEKPGRDPRPEFKTATFQDGVEDIKD
LQPGMVLEGVVTNVAAFGAFIDIGVHQDGLVHVSALSTKFVRDPHEVVKPGQVVKVKVME
VDVKRNRIGLTMRLADEPGQVPARSGGDRPAGGNRNGGQQRRAPEPAGAMAAAFAKLKR