Protein Info for RPSI07_RS15375 in Ralstonia solanacearum PSI07

Annotation: GGDEF-domain containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 776 transmembrane" amino acids 35 to 53 (19 residues), see Phobius details amino acids 59 to 81 (23 residues), see Phobius details amino acids 103 to 122 (20 residues), see Phobius details amino acids 128 to 145 (18 residues), see Phobius details amino acids 152 to 169 (18 residues), see Phobius details amino acids 175 to 195 (21 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 340 to 497 (158 residues), 113.1 bits, see alignment E=5.7e-37 PF00990: GGDEF" amino acids 342 to 495 (154 residues), 129.9 bits, see alignment E=8.1e-42 PF00563: EAL" amino acids 518 to 749 (232 residues), 245.7 bits, see alignment E=4.5e-77

Best Hits

KEGG orthology group: None (inferred from 100% identity to rsl:RPSI07_1585)

Predicted SEED Role

"GGDEF family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (776 amino acids)

>RPSI07_RS15375 GGDEF-domain containing protein (Ralstonia solanacearum PSI07)
MTVRTLAGRVARFMGVPADNPELLKAQYRAFSRQLPMMYFILISSTWAVAVTYRGITPAW
LTVGIPLLLTLACAMRILHWWSSRRIDPTPELALRALTRTNRLASVIAVSFTAWSFALFH
YGDPYTRSYLAFYMAITMIACIFCLMHLRSAAVTVTVIVNGAFIAFFAATGQPTFVAIAI
NMALVSFGLLVILMVHYRDFTLMVNAQTEARRREAEQGRLLHMIDDMPVAVMTVEPGTFA
INYANNTSKRLIDRIAHLLPIEADALLGTSIDVFHTHPEHQRRLLADPANLPHNTRIRLG
PEVLDLTVSAVRANDGSYIGPMLTWALVTKEVEAENRIRQLAHYDTLTGLANRTNFREQL
DARLEAPGVRLGLLYIDLDGFKLVNDTKGHRAGDALLERVAERLRAVCDRPGVAIARLGG
DEFAVLVPHDDADCAAALATSLIEALSAPYPLDADQSVRIGASVGIALAPAHGGDAENLL
AHADIALYAAKAAGKGLARLFCADLETRIQARARLETQLRSALESQDRLFVFYQPIVDVE
TGKVTAREALVRWHHVERGWVPPGEFVPIAEQSGLIDQLGRFVLHRACREATRWEDGARV
AVNVSPMQLGKATLAQTVRAALVDSGLAPDRLEIEVTETALIQNEAESFEDLRQLYDMGV
RVALDDFGTGYSSLAHLRAFPFDKIKIDRSFVHDLLERPDSAVLVKAIADLGRQLGVTTV
AEGVETQAHVRRIREAGCTEAQGYFYGRPAPSDEDRPRVDACSPARPAAALTSCAD