Protein Info for RPSI07_RS15290 in Ralstonia solanacearum PSI07

Annotation: phosphoglucosamine mutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02878: PGM_PMM_I
  • amino acids 3 to 144 (142 residues), 148.6 bits, E=1.9e-47
• TIGR01455: phosphoglucosamine mutase
  • amino acids 6 to 446 (441 residues), 590.2 bits, E=1.2e-181
• PF02879: PGM_PMM_II
  • amino acids 162 to 259 (98 residues), 65.3 bits, E=1.3e-21
• PF02880: PGM_PMM_III
  • amino acids 263 to 369 (107 residues), 111.6 bits, E=4.6e-36
• PF00408: PGM_PMM_IV
  • amino acids 378 to 446 (69 residues), 70.1 bits, E=2.8e-23

Best Hits

Swiss-Prot: 98% identical to GLMM_RALSO: Phosphoglucosamine mutase (glmM) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K03431, phosphoglucosamine mutase [EC: 5.4.2.10] (inferred from 100% identity to rsl:RPSI07_1569)

Predicted SEED Role

"Phosphoglucosamine mutase (EC 5.4.2.10)" in subsystem Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 5.4.2.10)

MetaCyc Pathways

• superpathway of anaerobic sucrose degradation (16/19 steps found)
• O-antigen building blocks biosynthesis (E. coli) (10/11 steps found)
• UDP-N-acetyl-D-glucosamine biosynthesis I (5/5 steps found)
• dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
• UDP-α-D-glucose biosynthesis (2/2 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• sucrose degradation II (sucrose synthase) (4/5 steps found)
• glycogen biosynthesis I (from ADP-D-Glucose) (3/4 steps found)
• sucrose degradation IV (sucrose phosphorylase) (3/4 steps found)
• colanic acid building blocks biosynthesis (8/11 steps found)
• peptidoglycan recycling I (10/14 steps found)
• GDP-α-D-glucose biosynthesis (2/3 steps found)
• trehalose degradation V (2/3 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• chitin biosynthesis (6/9 steps found)
• glucose and glucose-1-phosphate degradation (3/5 steps found)
• sucrose biosynthesis II (5/8 steps found)
• starch degradation V (2/4 steps found)
• glycogen degradation II (3/6 steps found)
• D-galactose degradation I (Leloir pathway) (2/5 steps found)
• glucosylglycerol biosynthesis (2/5 steps found)
• glycogen biosynthesis III (from α-maltose 1-phosphate) (4/8 steps found)
• glycogen degradation I (4/8 steps found)
• starch degradation III (1/4 steps found)
• starch biosynthesis (5/10 steps found)
• CDP-6-deoxy-D-gulose biosynthesis (1/5 steps found)
• CMP-legionaminate biosynthesis I (2/10 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (5/19 steps found)
• superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (7/24 steps found)
• streptomycin biosynthesis (2/18 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.4.2.10

Use Curated BLAST to search for 5.4.2.10

Protein Sequence (447 amino acids)

>RPSI07_RS15290 phosphoglucosamine mutase (Ralstonia solanacearum PSI07)
MSRKYFGTDGIRGRVGESPITPDFVLRLGYAAGRVLAHGSEAHGHGRPTVLIGKDTRLSG
YMLEAALEAGFTAAGVDVLMSGPLPTPGVAYLTRALRLSAGVVISASHNPYYDNGIKFFS
ATGDKLPDETESQIEAELEKPMEYAASDALGRARRIDDAAGRYIEFCKSTFPNDLNLFGM
KIVLDSAHGAAYHIAPHVFHELGADVISIGNQPNGRNINDGYGATAPAKLIEATRQHGAD
LGLAFDGDADRLQVVDKNGRLYNGDELLYVMVQARRAAGQAVPGAVGTLMTNLAVELALK
AQGVDFVRAKVGDRYVLEELKKRGWLLGGEGSGHLLCLDKHSTGDGIISALQVLAALRRS
GQTLEQVLDGVHLFPQKLINVRVERGFDWKAHAALQAALKVSEAELNGKGRVLIRPSGTE
PVVRVMVEAQDAALATKHAEQLAATIR