Protein Info for RPSI07_RS15200 in Ralstonia solanacearum PSI07

Annotation: Crp/Fnr family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 transmembrane" amino acids 185 to 196 (12 residues), see Phobius details PF00027: cNMP_binding" amino acids 75 to 159 (85 residues), 61.6 bits, see alignment E=8.8e-21 PF13545: HTH_Crp_2" amino acids 193 to 265 (73 residues), 73.3 bits, see alignment E=1.9e-24 PF00325: Crp" amino acids 218 to 249 (32 residues), 44 bits, see alignment 2.1e-15

Best Hits

Swiss-Prot: 40% identical to BTR_BORPE: Transcriptional regulatory protein btr (btr) from Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)

KEGG orthology group: K01420, CRP/FNR family transcriptional regulator, anaerobic regulatory protein (inferred from 100% identity to rsl:RPSI07_1550)

Predicted SEED Role

"transcriptional regulator, Crp/Fnr family" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (267 amino acids)

>RPSI07_RS15200 Crp/Fnr family transcriptional regulator (Ralstonia solanacearum PSI07)
MNPGSLQMQAPANTVHEARLLQFRRVREDDAAAAYPSSPSLATQCANCMMHWVCIAGAVP
SSRHQDLERMVQTWRRVRKGEALFRAGDPFHALYSVRSGSFKTVVSHPNGTEHVTGFQLT
GETLGMDGIAQNQHTCDAIALEDSTVCAMSFQCMEALCQDVPPLQHRLHQLLAGEIVRES
GLMLLLAGLSADARVATFLLNLSSRLHERGYSATDFTLRMTREEIGSYLGMQLETVSRTL
SRFQREGWIRVEGKHITLYNREALAGL