Protein Info for RPSI07_RS14425 in Ralstonia solanacearum PSI07

Annotation: acyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02771: Acyl-CoA_dh_N
  • amino acids 6 to 84 (79 residues), 47.3 bits, E=5.1e-16
• PF02770: Acyl-CoA_dh_M
  • amino acids 118 to 210 (93 residues), 57.7 bits, E=2.2e-19
• PF00441: Acyl-CoA_dh_1
  • amino acids 224 to 353 (130 residues), 87 bits, E=3e-28
• PF08028: Acyl-CoA_dh_2
  • amino acids 237 to 341 (105 residues), 32 bits, E=2.8e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to rsl:RPSI07_1385)

MetaCyc: 44% identical to pimeloyl-CoA dehydrogenase small subunit (Rhodopseudomonas palustris)
Pimeloyl-CoA dehydrogenase. [EC: 1.3.1.62]

Predicted SEED Role

"Acyl-CoA dehydrogenase family protein"

MetaCyc Pathways

• benzoyl-CoA degradation III (anaerobic) (3/9 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.62

Protein Sequence (376 amino acids)

>RPSI07_RS14425 acyl-CoA dehydrogenase (Ralstonia solanacearum PSI07)
MDFSFTDEQKQLADAVRRFVDKDYGFEARNKVVYSAGGVSQAHWDALAELGLTALPVPEA
QGGFDGRAMDLLVVMQELGRGLVVEPYAVTVLGTQALKLAGGQDALLEPVAGGALKLAVA
FGEPQSRYELFNVTTRAAQQGGGWTLSGAKAVVVHGGQADKLVVSARTGGEARDTSGLSL
FLVDREAAGVTVKDYRTIDNLRAADIRFDNAPATLLGKAGEAWEIIDAVADFGCVLLCAE
AIGLIDALNAATLEYTKTRQQFGVPIARFQALQHRMVDMFIHAEQARSITYLAAAHFEDG
DAEARRRYVSAAKARVGQAAREVGQEAVQLHGGMGVTNELPAAHMFKRLTMINTTLGDVD
HHLARFASLPGFRNAA