Protein Info for RPSI07_RS14155 in Ralstonia solanacearum PSI07

Annotation: adenosine deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00962: A_deaminase
  • amino acids 15 to 339 (325 residues), 295.7 bits, E=2.2e-92
• TIGR01430: adenosine deaminase
  • amino acids 15 to 337 (323 residues), 372.4 bits, E=9e-116

Best Hits

Swiss-Prot: 97% identical to ADE_RALSO: Adenine deaminase (RSc2098) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K01488, adenosine deaminase [EC: 3.5.4.4] (inferred from 100% identity to rsl:RPSI07_1331)

Predicted SEED Role

"Adenosine deaminase (EC 3.5.4.4)" in subsystem Purine conversions (EC 3.5.4.4)

MetaCyc Pathways

• adenosine nucleotides degradation II (4/5 steps found)
• purine nucleotides degradation II (aerobic) (8/11 steps found)
• adenine and adenosine salvage III (2/4 steps found)
• adenine and adenosine salvage V (1/3 steps found)
• purine deoxyribonucleosides degradation II (1/3 steps found)
• purine deoxyribonucleosides degradation I (1/4 steps found)
• purine ribonucleosides degradation (1/6 steps found)
• superpathway of purine deoxyribonucleosides degradation (1/7 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.5.4.4

Use Curated BLAST to search for 3.5.4.4

Protein Sequence (345 amino acids)

>RPSI07_RS14155 adenosine deaminase (Ralstonia solanacearum PSI07)
MPISPALAERIATSPKAELHIHIEGSLEPELMFALAERNGVKLPYASVEAVRAAYAFNDL
QSFLDLYYAGASVLLTEQDFYDMTAAYVARAVADNVRHAEIFFDPQTHTARDVPMHVVIG
GIVRALDDAEREHGFSSRLILCFLRHLSEEDAFDTLEAALPYIQDPANRIIGVGLDSSER
GNPPEKFARVFARCKALGLRLVAHAGEEGPAQYVIDALDILQVERIDHGVRAIDDAGLVK
RLAANRVALTVCPLSNEKLKVYPDLRDHSLKQLLDAGCAVTLHSDDPAYFGGYMNTNWLA
TFNALDLSAADAHTLARNSFEASFLPEQDKALWLARVDDHWKPSH