Protein Info for RPSI07_RS14005 in Ralstonia solanacearum PSI07

Annotation: sigma-54-dependent Fis family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 PF00072: Response_reg" amino acids 9 to 118 (110 residues), 83.8 bits, see alignment E=2.5e-27 PF00158: Sigma54_activat" amino acids 148 to 313 (166 residues), 211.5 bits, see alignment E=1.7e-66 PF14532: Sigma54_activ_2" amino acids 149 to 318 (170 residues), 67.2 bits, see alignment E=4.7e-22 PF07728: AAA_5" amino acids 171 to 288 (118 residues), 26 bits, see alignment E=2e-09

Best Hits

Swiss-Prot: 48% identical to DCTD_RHILE: C4-dicarboxylate transport transcriptional regulatory protein DctD (dctD) from Rhizobium leguminosarum

KEGG orthology group: K10126, two-component system, NtrC family, C4-dicarboxylate transport response regulator DctD (inferred from 100% identity to rsl:RPSI07_1302)

Predicted SEED Role

"C4-dicarboxylate transport transcriptional regulatory protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (442 amino acids)

>RPSI07_RS14005 sigma-54-dependent Fis family transcriptional regulator (Ralstonia solanacearum PSI07)
MNVNDDVEVMVIEDEDDVRLGCLQALQLEGLRAVGYDSVERVPRTLPRDVRYVVVSDIRL
PGMDGMAFLRQLVERDADLPVILITGHGDVQTAVQAMRDGAYDFIQKPFQSHELAAVVKR
ALEKRTLALEVRQLRHQLAARGGLENRIIGRSQAVSALRELVEDLAPLPTDVLIHGETGT
GKELIARCLHDLSGRKGPFVALNCGGLPETLFDSEIFGHEAGSFSGATKQRIGKIEYAQG
GTLFLDEIESMPIPMQVKLLRVLQERVVERLGSNRPIPVDFRVIAATKSDLLALADEGKF
RADLHFRLNVAVLELPPLRARQEDIPLLFDTFVRQAALRLERPAPPVREATVRELLAHKW
PGNVRELRNEAERYVLGLKRGADAETGPMPLADTVDAFERSLILEELRRHQGNLSRAAEA
MLIPKTTLFGKIRKHDIRHQEY