Protein Info for RPSI07_RS14000 in Ralstonia solanacearum PSI07

Annotation: alpha-hydroxy-acid oxidizing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 PF01070: FMN_dh" amino acids 14 to 376 (363 residues), 461.7 bits, see alignment E=2.4e-142 PF03060: NMO" amino acids 258 to 336 (79 residues), 29 bits, see alignment E=1.1e-10 PF01645: Glu_synthase" amino acids 298 to 338 (41 residues), 23.6 bits, see alignment 4.1e-09

Best Hits

Swiss-Prot: 48% identical to LLDD_PSEE4: L-lactate dehydrogenase (lldD) from Pseudomonas entomophila (strain L48)

KEGG orthology group: K00101, L-lactate dehydrogenase (cytochrome) [EC: 1.1.2.3] (inferred from 100% identity to rsl:RPSI07_1301)

Predicted SEED Role

"L-lactate dehydrogenase (EC 1.1.2.3)" in subsystem L-rhamnose utilization or Lactate utilization or Respiratory dehydrogenases 1 (EC 1.1.2.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (383 amino acids)

>RPSI07_RS14000 alpha-hydroxy-acid oxidizing protein (Ralstonia solanacearum PSI07)
MKSALTIADLKDQARRRVPKMFFDYADSGSWTEGTYRANEADFGAIKLRQRVLVDMSGRS
LDTTMAGQAVSMPVALAPTGLTGMQHADGEILAAQAAEAFGVPFSLSTMSICSIEDVAAH
TTQPFWFQLYVMRDRSFIEALIERAKAARCSALIVTLDLQILGQRHKDVRNRLSAPPKIT
PLHLWQMACRPRWCLNMARTKRHSFGNIVGHAKNVSDLSSLSVWTAEQFDPRLSWKDVEW
IKSRWGGKLILKGILDEDDARAAVESGADALIVSNHGGRQLDGAPSSIEVLPRIVDAVGD
RIEIHLDSGIRSGQDVLKAVALGARGVYIGRPFLYGLGAGGRRGVTRALEIIRSELDVTM
ALTGKRVITDVDRSVLVDRGPCR