Protein Info for RPSI07_RS13395 in Ralstonia solanacearum PSI07

Annotation: branched-chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 transmembrane" amino acids 32 to 98 (67 residues), see Phobius details amino acids 104 to 124 (21 residues), see Phobius details amino acids 133 to 154 (22 residues), see Phobius details amino acids 180 to 199 (20 residues), see Phobius details amino acids 226 to 247 (22 residues), see Phobius details amino acids 266 to 291 (26 residues), see Phobius details amino acids 302 to 325 (24 residues), see Phobius details PF02653: BPD_transp_2" amino acids 54 to 314 (261 residues), 111 bits, see alignment E=3e-36

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 100% identity to rsl:RPSI07_1175)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (341 amino acids)

>RPSI07_RS13395 branched-chain amino acid ABC transporter permease (Ralstonia solanacearum PSI07)
MNVLQQRARSARPEDPARPHGLPDARWSPLEIAFWCVPVLVFFILPDYLVFGSQVLIVGL
FALSLDLVLGYAGIVSLGHAGFFGLGAYTAGLLAAHGWGEPLSGLFAAAVVAALAGFCVS
FLVVRGQDLTRLMVTLGIGLMLYEAANKMAFLTGGVDGLSGVTMETLLGSFEFDLSGRTA
YVYSLAVLFGVFVLLRRLVRSPFGLSLRGIQQGPGRMPALGADVRMRLVAAFTVSAAIAG
VAGGLLAQTTQFVGLDALGFSRSAELLIMLVLGGAGRLYGALVGAAVFMLAQDVLAGINP
VYWQFWIGLLLMVIVLFARGGILGGLESAVRAWRARRGGPA