Protein Info for RPSI07_RS13290 in Ralstonia solanacearum PSI07

Annotation: sugar ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 483 transmembrane" amino acids 54 to 72 (19 residues), see Phobius details amino acids 78 to 96 (19 residues), see Phobius details amino acids 101 to 119 (19 residues), see Phobius details amino acids 125 to 145 (21 residues), see Phobius details amino acids 419 to 437 (19 residues), see Phobius details PF16963: PelD_GGDEF" amino acids 355 to 479 (125 residues), 149.5 bits, see alignment E=2.2e-48

Best Hits

KEGG orthology group: None (inferred from 100% identity to rsl:RPSI07_1154)

Predicted SEED Role

"Extracellular Matrix protein PelD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (483 amino acids)

>RPSI07_RS13290 sugar ABC transporter (Ralstonia solanacearum PSI07)
MEADAVQADPSSKAKPAAAASDARQQDRRRNAQGIGASTWYGRLIAPTLTRRTPILETLG
ATIVAIGIVWLFEPDNPLLLGHGFPWVWLVPLILALRYGTLLGAVAALVMVGAWWVFYGQ
GAFPRMYFLGGLMMMLVGGQYGDIWGARLSRARIVNGYLNDRLAALTKNHFLLRLSHERL
ENDLLAKPTTLRDTLTQLRNLALAAREHASGDDAPDVAQLPGATQFLQWASQACQLEVAA
MVRVAGSRVDPAPVARVGTPFEIVADDPLIRHCIDTHTLGHPQAPELRHEDGSRYVACAP
ILSGADELIGIVVVQQMPFLSLSYENLQFLLVLLGYYADGVRHLTVSSEILDLVPDAPYE
FALDLGRLARLHRDTGIDSSVVALIFGHDEASDALFEQVVRSRRALDVVWQVRGSARRAI
VTLMPLSGAGAVSAYLVRIEDSLRAQFGVDFEAAHISVQTLHVTGEHPGEALSRFLARCH
LDG