Protein Info for RPSI07_RS12735 in Ralstonia solanacearum PSI07

Annotation: GGDEF domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 551 signal peptide" amino acids 1 to 41 (41 residues), see Phobius details transmembrane" amino acids 345 to 365 (21 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 389 to 548 (160 residues), 150.6 bits, see alignment E=1.7e-48 PF00990: GGDEF" amino acids 392 to 547 (156 residues), 142 bits, see alignment E=7.6e-46

Best Hits

KEGG orthology group: None (inferred from 100% identity to rsl:RPSI07_1042)

Predicted SEED Role

"FIG00974082: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (551 amino acids)

>RPSI07_RS12735 GGDEF domain-containing protein (Ralstonia solanacearum PSI07)
MAALAPPPHAAVRRIARVVLALLMLLAGVALCWFAAGIVADAMGARELRQTFDARRQLAE
QVAEGMASQITADVALLRAVPLTLAEVESIPAGVARVDTRRWNLMDEGLRVREAMAYPEV
RAACTFLNAANGNLGLDYTWVVDTRGYVVLASNAGRPGSFIGMQSALQPYMRAAMLGGLG
EQFTVGPMTGVPGLFFAAPIYDARGHLVAAIATKVNLARLQHWVSHPTSLVADANGLIIL
STDASLAGKALPDSRVQRMTPSERFAEYQRVDFEPWSYQAAASAQRAVPSWVPVEVRDAL
VWRTGSEIPSLTVSRNASADLTVVVAEPLVPWPQQLATHGRNRSLGFVLFVSGLLIFVLV
VWSLMRERQHHRVTRHLNQRLQRTNSALANEAHFDHLTGVLTRRRFLALFETVLTRTHVR
GEQLVLVLADLDHFKRINDTWGHAVGDLALQRFASLATNVMRSSDLIGRLGGEEFAVVMS
RTTLEDAAGVVERLRAAVAEADESLPSGLAMTVSLGMTACRPGDTASEMLRRADLALYRA
KESGRNRHAAG