Protein Info for RPSI07_RS12670 in Ralstonia solanacearum PSI07

Annotation: 50S ribosomal protein L28

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00009: ribosomal protein bL28
  • amino acids 1 to 57 (57 residues), 95.8 bits, E=8.1e-32
• PF00830: Ribosomal_L28
  • amino acids 3 to 62 (60 residues), 101.9 bits, E=7.5e-34

Best Hits

Swiss-Prot: 100% identical to RL28_RALSO: 50S ribosomal protein L28 (rpmB) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K02902, large subunit ribosomal protein L28 (inferred from 99% identity to rpf:Rpic12D_2323)

MetaCyc: 75% identical to 50S ribosomal subunit protein L28 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

No annotation

Protein Sequence (77 amino acids)

>RPSI07_RS12670 50S ribosomal protein L28 (Ralstonia solanacearum PSI07)
MARVCQVTGKAPMVGNNVSHANNKTKRRFLPNLQNRRFWVESENRWVSLRVSNAGLRLID
KKGIDEVLADLRARGEV