Protein Info for RPSI07_RS12290 in Ralstonia solanacearum PSI07

Annotation: sulfite exporter TauE/SafE family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 36 to 58 (23 residues), see Phobius details amino acids 80 to 102 (23 residues), see Phobius details amino acids 107 to 127 (21 residues), see Phobius details amino acids 133 to 152 (20 residues), see Phobius details amino acids 155 to 174 (20 residues), see Phobius details amino acids 185 to 201 (17 residues), see Phobius details amino acids 207 to 228 (22 residues), see Phobius details amino acids 235 to 253 (19 residues), see Phobius details PF01925: TauE" amino acids 13 to 250 (238 residues), 120.7 bits, see alignment E=4.2e-39

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 100% identity to rsl:RPSI07_0949)

Predicted SEED Role

"Transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (255 amino acids)

>RPSI07_RS12290 sulfite exporter TauE/SafE family protein (Ralstonia solanacearum PSI07)
MTTLSFSTALLVAAAGVYAGAQNALAGGGSFITFPALLLAGLNPLAANMTSTIALFPSQI
TSSIAGRKLAGGVSAGKHHLSLTQLIVISLVGGVLGALLLLATPASFFARLVPYLVLFAT
SVFAWGSFRRKPLHTAAGMPTGGLALAQFGIAVYGGYFGGGIGFLMLAALTIAGQQVRMA
GATKNVLAMTMNASAVAVFVFSPQVDWAAVVALGIGGIAGGFAGAWLLHRLPEKVLRGFV
VVVGIVLTVWLFMRA