Protein Info for RPSI07_RS11720 in Ralstonia solanacearum PSI07

Annotation: pyrroline-5-carboxylate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03446: NAD_binding_2
  • amino acids 6 to 92 (87 residues), 21.7 bits, E=2.7e-08
• PF03807: F420_oxidored
  • amino acids 6 to 99 (94 residues), 70.5 bits, E=2.3e-23
• TIGR00112: pyrroline-5-carboxylate reductase
  • amino acids 8 to 267 (260 residues), 256.9 bits, E=1.2e-80
• PF14748: P5CR_dimer
  • amino acids 163 to 267 (105 residues), 119.1 bits, E=1.5e-38

Best Hits

Swiss-Prot: 45% identical to P5CR_PSEAE: Pyrroline-5-carboxylate reductase (proC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00286, pyrroline-5-carboxylate reductase [EC: 1.5.1.2] (inferred from 100% identity to rsl:RPSI07_0828)

MetaCyc: 37% identical to pyrroline-5-carboxylate reductase (Hordeum vulgare)
Pyrroline-5-carboxylate reductase. [EC: 1.5.1.2]

Predicted SEED Role

"Pyrroline-5-carboxylate reductase (EC 1.5.1.2)" in subsystem Proline Synthesis (EC 1.5.1.2)

MetaCyc Pathways

• L-arginine degradation VI (arginase 2 pathway) (4/4 steps found)
• L-proline biosynthesis I (from L-glutamate) (4/4 steps found)
• L-proline biosynthesis III (from L-ornithine) (3/3 steps found)
• L-arginine degradation XIII (reductive Stickland reaction) (4/5 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.2

Protein Sequence (274 amino acids)

>RPSI07_RS11720 pyrroline-5-carboxylate reductase (Ralstonia solanacearum PSI07)
MLDTLKFGFIGGGNMASALIGGLIARGAKGANIVVVDPTEPARAHAAQTWGATATAAPGA
ELADRDVIVLAVKPQQMREVCAQLAPHLRDSLVLSVAAGLRIQDLSRWLNGHARIVRAMP
NTPALSGQGMTGLAANDGLAGTDRDTASAIANAVGKSVWVPSEAQIDAVTAISGSGPAYV
FYFIEAMQQAAQELGLSAEAGRLLAAETFIGAATLAGQSSEPVEVLRERVTSKGGTTYAA
ITAMEAAGIKPAFVRAMHAAAARSKEMGEAFGHD