Protein Info for RPSI07_RS11565 in Ralstonia solanacearum PSI07

Annotation: tRNA 2-thiouridine(34) synthase MnmA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 PF03054: tRNA_Me_trans" amino acids 4 to 199 (196 residues), 266.9 bits, see alignment E=3.5e-83 PF02540: NAD_synthase" amino acids 4 to 44 (41 residues), 21.2 bits, see alignment 4.4e-08 TIGR00420: tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase" amino acids 4 to 357 (354 residues), 437.2 bits, see alignment E=2e-135 PF20259: tRNA_Me_trans_M" amino acids 204 to 272 (69 residues), 76.1 bits, see alignment E=3.6e-25 PF20258: tRNA_Me_trans_C" amino acids 282 to 357 (76 residues), 72.3 bits, see alignment E=1.1e-23

Best Hits

Swiss-Prot: 95% identical to MNMA_RALSO: tRNA-specific 2-thiouridylase MnmA (mnmA) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K00566, tRNA-specific 2-thiouridylase [EC: 2.8.1.-] (inferred from 100% identity to rsl:RPSI07_0788)

MetaCyc: 58% identical to tRNA-specific 2-thiouridylase (Escherichia coli K-12 substr. MG1655)
RXN0-2023 [EC: 2.8.1.13]

Predicted SEED Role

"tRNA-specific 2-thiouridylase MnmA"

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.-

Use Curated BLAST to search for 2.8.1.- or 2.8.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (370 amino acids)

>RPSI07_RS11565 tRNA 2-thiouridine(34) synthase MnmA (Ralstonia solanacearum PSI07)
MSGKRVVVGMSGGVDSSVTAWLLKQQGYEVVGLFMKNWEDDDDSEYCSTRQDWIDVVSVA
DLIGVDVEAVNFAAEYKDRVFADFLREYSAGRTPNPDVLCNAEIKFKAFLDHAMALGADT
IATGHYARVREVDGRFELLKAFDHTKDQSYFLHRLNQAQLCRTLFPLGEIPKTRVREIAA
EIGLPNAKKKDSTGICFIGERPFRDFLNRYLPTKPGPIKTPDDKTIGQHIGLAFYTLGQR
KGIGIGGSRDGNGDAWYVARKDMAANTLYVVQGHDHPWLLAHTVHADDLSWVAGHPPAEG
TQLAAKTRYRQTDAPCAVTRAAGGALTLTFPQAQWAVTPGQSAVLYDGDVCLGGGIIAST
EAMLVEATTA