Protein Info for RPSI07_RS11315 in Ralstonia solanacearum PSI07

Annotation: magnesium and cobalt transport protein CorA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 transmembrane" amino acids 261 to 282 (22 residues), see Phobius details amino acids 294 to 313 (20 residues), see Phobius details TIGR00383: magnesium and cobalt transport protein CorA" amino acids 2 to 319 (318 residues), 254.2 bits, see alignment E=1e-79 PF01544: CorA" amino acids 28 to 315 (288 residues), 197.1 bits, see alignment E=2.1e-62

Best Hits

Swiss-Prot: 44% identical to CORA_SALTI: Magnesium transport protein CorA (corA) from Salmonella typhi

KEGG orthology group: K03284, metal ion transporter, MIT family (inferred from 100% identity to rsl:RPSI07_0736)

MetaCyc: 44% identical to Ni2+/Co2+/Mg2+ transporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-141; TRANS-RXN-141A; TRANS-RXN-141B

Predicted SEED Role

"Magnesium and cobalt transport protein CorA" in subsystem Campylobacter Iron Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (320 amino acids)

>RPSI07_RS11315 magnesium and cobalt transport protein CorA (Ralstonia solanacearum PSI07)
MINLFVVQKGRLAQEQVEDRNELLQHKPIWIDVVDPEDEELAWIKDTYGVVLPELEQLGD
LEASARYFEGEDGHIHIRTDFLLDEEASSRNVRVAFVLTKDVLFSIHDEDLPAFRLVRMR
ARLRPGSVRNAKDVLMDLYATDAEYSADSIEEVYERLEDASKRVLADEVTDQAAADVLEI
IARVEDLNGRIRRNVMDTRRAVSFLLRSQMLSPDQQDEARQVLRDIDSIENHTAFLSDKV
NFLMDATVGFININQNKIIKLFSVVSVALMPPTLIASIYGMNFKVMPELEWAEGYPYAIA
LMIVSAAIPLVYFRRKGWLK