Protein Info for RPSI07_RS11265 in Ralstonia solanacearum PSI07

Annotation: TlpA family protein disulfide reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00578: AhpC-TSA
  • amino acids 46 to 155 (110 residues), 62.5 bits, E=7.9e-21
• PF08534: Redoxin
  • amino acids 46 to 163 (118 residues), 78.6 bits, E=8.7e-26
• PF13905: Thioredoxin_8
  • amino acids 62 to 154 (93 residues), 39.1 bits, E=1.6e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to rsl:RPSI07_0725)

Predicted SEED Role

"Cytochrome c-type biogenesis protein CcmG/DsbE, thiol:disulfide oxidoreductase" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange

Protein Sequence (174 amino acids)

>RPSI07_RS11265 TlpA family protein disulfide reductase (Ralstonia solanacearum PSI07)
MSRRQTLIALILAGIAAAVLGVYASHRATEPKPPADGAVAAFFGAKLPDANGAPIDLSAF
RGQPVVINFWAPWCGPCVEEMPELSALAQEQKARVKFVGIGIDSATNIQAFLGKVPVTYP
IAVAGFGGTELGRQLGNQAGGLPFTVILNAQGEITFRKMGRVHADELRAALQRT