Protein Info for RPSI07_RS11180 in Ralstonia solanacearum PSI07

Annotation: EamA family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 transmembrane" amino acids 18 to 39 (22 residues), see Phobius details amino acids 45 to 67 (23 residues), see Phobius details amino acids 79 to 99 (21 residues), see Phobius details amino acids 105 to 123 (19 residues), see Phobius details amino acids 130 to 151 (22 residues), see Phobius details amino acids 157 to 174 (18 residues), see Phobius details amino acids 186 to 204 (19 residues), see Phobius details amino acids 210 to 233 (24 residues), see Phobius details amino acids 245 to 265 (21 residues), see Phobius details amino acids 271 to 291 (21 residues), see Phobius details PF00892: EamA" amino acids 156 to 284 (129 residues), 64.1 bits, see alignment E=8e-22

Best Hits

Swiss-Prot: 46% identical to RHTA_ECOL6: Threonine/homoserine exporter RhtA (rhtA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 100% identity to rsl:RPSI07_0705)

MetaCyc: 46% identical to L-threonine/L-homoserine exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-242; TRANS-RXN0-0244

Predicted SEED Role

"Integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (299 amino acids)

>RPSI07_RS11180 EamA family transporter (Ralstonia solanacearum PSI07)
MSSPSTVAPTSPTGHPSLWVPVLALAGSMVSVCVGNAFAKTLFPALGAAGTVTYRVTIGA
MILLALWRPWRLRLHRRDAGRIALYGVTLASMNLLFYLSLARLPIGIAIAIEFTGPLVLA
VALSRRALDFVWIGLAVAGLLILTVGGRAVGQIDPRGAAYALAAGVCWALYIVTGKNVGA
LPAGQATSLGMAAGALFAIPFGVAQAGPALLAPSLIVAGLGLGVLSSAVPYSLEMVALKH
LPGRTFSVLLSLEPAIGALAGAVVLHEQLSARQWVAIAAIIAASAGCAATARARRAADA