Protein Info for RPSI07_RS10335 in Ralstonia solanacearum PSI07

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 29 to 176 (148 residues), 93.3 bits, E=1.1e-30

Best Hits

Swiss-Prot: 59% identical to MLAF_HAEIN: Intermembrane phospholipid transport system ATP-binding protein MlaF (mlaF) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02065, putative ABC transport system ATP-binding protein (inferred from 100% identity to rsl:RPSI07_0536)

Predicted SEED Role

"Uncharacterized ABC transporter, ATP-binding protein YrbF"

Protein Sequence (279 amino acids)

>RPSI07_RS10335 ABC transporter ATP-binding protein (Ralstonia solanacearum PSI07)
MSSQSSTAVVELDQVDFAYQPGARRILSGLCMRVPKGSVVAVMGGSGCGKTTVLRLIGGQ
VAAAAGTVRVHGADIGAMDKPALYAARRQMGMLFQFGALFSDMSVFDNVAFPLREHTELP
ELLIRDLVLMKLNAVGLRGARDLMPSQISGGMARRVALARAIALDPSLILYDEPFAGLDP
ISLGLTASLIRSLNDALGATSIIVSHDVQETFQIADYVYFVANGSIAAEGTPAELSASTD
PFVRQFVRGEPDGPVPFHYPGVPLAEDFGVGGRRDGEAR