Protein Info for RPSI07_RS10290 in Ralstonia solanacearum PSI07

Annotation: type IV pilus secretin PilQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 717 signal peptide" amino acids 1 to 39 (39 residues), see Phobius details PF11741: AMIN" amino acids 64 to 146 (83 residues), 40.2 bits, see alignment E=6.2e-14 amino acids 177 to 279 (103 residues), 86.6 bits, see alignment E=2.1e-28 TIGR02515: type IV pilus secretin PilQ" amino acids 291 to 710 (420 residues), 517.1 bits, see alignment E=1.9e-159 PF07660: STN" amino acids 317 to 363 (47 residues), 33.7 bits, see alignment 5.2e-12 PF03958: Secretin_N" amino acids 389 to 466 (78 residues), 48.6 bits, see alignment E=1.5e-16 PF00263: Secretin" amino acids 556 to 710 (155 residues), 173.1 bits, see alignment E=8.2e-55

Best Hits

KEGG orthology group: K02666, type IV pilus assembly protein PilQ (inferred from 100% identity to rsl:RPSI07_0527)

Predicted SEED Role

"Type IV pilus biogenesis protein PilQ" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (717 amino acids)

>RPSI07_RS10290 type IV pilus secretin PilQ (Ralstonia solanacearum PSI07)
MTMRRVKGGLAQAVRVARGGAVAWLSLCMLMVGGQALAQQAVTAPATNAIERVEQASAGE
ATVVTVTLKGAPAQRPVEFSTQQPARIAIDFFGTAFAQGRANYQYGGKLLRSASVVQIGD
RTRVVLDLARQSQYKSEIRGNQYVLTLGAAPTASAAPVPTFAAPVPVAGVDRPAVRNIDF
RRGEELAGRVVVDLSTSNSAINIAQQGQNLVVDFVGAALPQSLRRRYDVSDFGTPVQAMR
ATDNGTGARLVIEPRGNWQYSSYQTDTQFVVEVRPTKEDPNKLIAGPGYRGERMSLNFQN
IDIRSLLQVFADFTNLNIVTSDSVTGTLSLRLKDVPWDQALQIVLDSKGLASRRNGNVLW
VAPRGELATKEKAELESQQQVTELEPLRSQVFRLNYQRADDVRNMLLGTGTAGGGAAAGG
TASRILSKRGSLTSDARTNQLFVSDIPSKLEEVQAFLLKIDIPVRQVMIEARIVEADDTF
SRNLGAKLGFASKTNGAGYGNTYTNVVSPVTTNGTWDNSPALSFPANGINGVSAASVAVS
LFNAGAGRFLALELSALEADGRGKIISSPRVVTADNIKALIEQGTELPYQAATSSGATSV
QFRKANLKLEVTPKITPDGNVFLDVDVNKDSVGTQTTNGFAINTKHVQTQVLVENGGTVV
IGGIYTQNERTDVNKVPLLGDIPVLGNLFKSTAKTNDRTELLVFLTPRVLSDQLSLK