Protein Info for RPSI07_RS10195 in Ralstonia solanacearum PSI07

Annotation: protein-disulfide reductase DsbD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 609 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 186 to 215 (30 residues), see Phobius details amino acids 227 to 250 (24 residues), see Phobius details amino acids 261 to 284 (24 residues), see Phobius details amino acids 306 to 335 (30 residues), see Phobius details amino acids 341 to 363 (23 residues), see Phobius details amino acids 374 to 396 (23 residues), see Phobius details amino acids 402 to 423 (22 residues), see Phobius details amino acids 436 to 457 (22 residues), see Phobius details PF11412: DsbD_N" amino acids 33 to 147 (115 residues), 110.3 bits, see alignment E=1.8e-35 PF13386: DsbD_2" amino acids 191 to 379 (189 residues), 43.3 bits, see alignment E=1.2e-14 PF02683: DsbD" amino acids 192 to 370 (179 residues), 76.4 bits, see alignment E=9.1e-25 PF13899: Thioredoxin_7" amino acids 493 to 574 (82 residues), 58.7 bits, see alignment E=1.6e-19 PF13098: Thioredoxin_2" amino acids 502 to 595 (94 residues), 43.6 bits, see alignment E=9.6e-15

Best Hits

Swiss-Prot: 92% identical to DSBD_RALSO: Thiol:disulfide interchange protein DsbD (dsbD) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K04084, thiol:disulfide interchange protein DsbD [EC: 1.8.1.8] (inferred from 100% identity to rsl:RPSI07_0508)

Predicted SEED Role

"Cytochrome c-type biogenesis protein DsbD, protein-disulfide reductase (EC 1.8.1.8)" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange (EC 1.8.1.8)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (609 amino acids)

>RPSI07_RS10195 protein-disulfide reductase DsbD (Ralstonia solanacearum PSI07)
MTPSAFQLLRRLLQLGMLLVAMATLALPARAADDFLPPEQAFRFSAAQIDGQTVEVKFAI
ADGYYMYRERLAVAADPATVTFAPLELPPGKVKFDDTFNKDVETYRHELAFRVRARDAAG
PFSLIVTSQGCADQGVCYPPMKSRFRVELAAASPVPPVGGALDAAESSDVLGGRIASTLG
GGNLGAIAALFFGLGLLLTFTPCVLPMLPILSAIVVGEHATRMRAAAVSLAYVLGMAVVY
TAVGVAAGLAGQGLQAALQNAWVLGAFAALMVVLSLSMFGLYELQLPAAWHHRLTQASNR
LSGGQVAGAAVMGALSALIVSPCVTPALAGALAYIAQTGNAVVGGAALFSMAIGMGVPLV
LVGMGAGNLLPRAGYWLVVTKAIFGFILLGVALWIVQPVLPAWLAMVAWAVLLIAAAVFL
RTFDSLPADAGPLPRLGKVVGVVLALAGAVQLVGMAAGGRDPLQPLAGVMRASTGGQSDT
RGVVFRRVKSVSEVDDAVRTASATGRPVMLDFYADWCVSCKEMERLTFTDARVRAALADV
VLLQADVTADNADDQALLKRFGLFGPPATIFFDAQGSQAPARVVGFERADTFLASLRRAL
GTVQAKPST