Protein Info for RPSI07_RS10070 in Ralstonia solanacearum PSI07

Annotation: 50S ribosomal protein L2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01171: ribosomal protein uL2
  • amino acids 4 to 274 (271 residues), 414.9 bits, E=7.6e-129
• PF00181: Ribosomal_L2
  • amino acids 42 to 117 (76 residues), 108.5 bits, E=1.3e-35
• PF03947: Ribosomal_L2_C
  • amino acids 126 to 251 (126 residues), 187.6 bits, E=8.5e-60

Best Hits

Swiss-Prot: 98% identical to RL2_RALSO: 50S ribosomal protein L2 (rplB) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K02886, large subunit ribosomal protein L2 (inferred from 100% identity to rsl:RPSI07_0481)

MetaCyc: 69% identical to 50S ribosomal subunit protein L2 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L2p (L8e)" in subsystem Ribosome LSU bacterial

Protein Sequence (276 amino acids)

>RPSI07_RS10070 50S ribosomal protein L2 (Ralstonia solanacearum PSI07)
MALVKTKPTSPGRRSMVKVVNADLHKGAPYAPLLEKQHQKSGRNNNGHITTRHKGGGHKH
HYRVVDFKRNDKDGIPAKIERLEYDPNRSANIALVLFADGERRYIIAPKGAVVGQVVANG
PEAPIKAGNNLPIRNIPVGTTIHCVEILPGKGAQIARSAGTSAVLLAREGIYAQVRLRSG
EVRRVHIECRATIGEVGNEEHSLRQIGKAGATRWRGIRPTVRGVAMNPVDHPHGGGEGKT
AAGRDPVSPWGTPTKGYRTRRNKRTTSMIVQRRHKR