Protein Info for RPSI07_RS09995 in Ralstonia solanacearum PSI07

Annotation: DUF1175 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 signal peptide" amino acids 1 to 39 (39 residues), see Phobius details PF06672: DUF1175" amino acids 51 to 241 (191 residues), 260.5 bits, see alignment E=6e-82

Best Hits

Swiss-Prot: 59% identical to YFAT_ECOLI: Uncharacterized protein YfaT (yfaT) from Escherichia coli (strain K12)

KEGG orthology group: K09934, hypothetical protein (inferred from 100% identity to rsl:RPSI07_0466)

Predicted SEED Role

"FIG00638487: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (242 amino acids)

>RPSI07_RS09995 DUF1175 domain-containing protein (Ralstonia solanacearum PSI07)
MKPRALAHVPAVSPSRRRWLAMAAAGLLAQTFASGVHALSGWADAATAGPDALAPEQSAV
FRAWFVRIVNEQLRQGPTPRWTHRDCAGLVRFAAAEALRPHDARWLRANGMRDAESARQL
PPELSLTPAQRTLTQRWTRIDGSTGAYVSALALIQQNSRFVAKDVNQALPGDLLFFDQGD
DQHLMIWMDRYIAYHTGTVTRTDTGLRAVPVSELMQWKDSRWQPQGGNPNFIGVFRLAFL
TR