Protein Info for RPSI07_RS09865 in Ralstonia solanacearum PSI07

Annotation: carbohydrate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 76 to 98 (23 residues), see Phobius details amino acids 110 to 130 (21 residues), see Phobius details amino acids 142 to 163 (22 residues), see Phobius details amino acids 186 to 211 (26 residues), see Phobius details amino acids 242 to 263 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 90 to 268 (179 residues), 37.8 bits, see alignment E=8.4e-14

Best Hits

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 100% identity to rsl:RPSI07_0447)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, permease protein UgpE (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (276 amino acids)

>RPSI07_RS09865 carbohydrate ABC transporter permease (Ralstonia solanacearum PSI07)
MPNPSNNEHKRKIARAITLVVYVAFAVLPLYWMLSMSLKTNEETLAGFSIWPKLVTFDNY
KIIFTDPSWYWGYINSILYVTMNTVLSTVVALPAAYAFSRYRFLGDKHMFFWLLTNRMTP
PAVFLLPFFQLYSTVGLMDTHLGVALAHMLFNVPLAVWILEGFMSGIPREIDETAYIDGY
SFPAFFLKIFLPLIKAGVGVTAFFCFMFSWVELLLARTLTSVDAKPITAVMTRTVSASGM
DWGVLAAAGVLTIIPGALVIWFVRNYIAKGFAMGRV