Protein Info for RPSI07_RS09850 in Ralstonia solanacearum PSI07

Annotation: glycerol kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 498 TIGR01311: glycerol kinase" amino acids 2 to 489 (488 residues), 707.3 bits, see alignment E=3.9e-217 PF00370: FGGY_N" amino acids 3 to 249 (247 residues), 254.2 bits, see alignment E=1.4e-79 PF02782: FGGY_C" amino acids 259 to 447 (189 residues), 160.6 bits, see alignment E=4.3e-51

Best Hits

Swiss-Prot: 98% identical to GLPK_RALSO: Glycerol kinase (glpK) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K00864, glycerol kinase [EC: 2.7.1.30] (inferred from 100% identity to rsl:RPSI07_0444)

MetaCyc: 58% identical to glycerol kinase (Escherichia coli K-12 substr. MG1655)
Glycerol kinase. [EC: 2.7.1.30]

Predicted SEED Role

"Glycerol kinase (EC 2.7.1.30)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization or Glycerolipid and Glycerophospholipid Metabolism in Bacteria or MLST (EC 2.7.1.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (498 amino acids)

>RPSI07_RS09850 glycerol kinase (Ralstonia solanacearum PSI07)
MEYLLALDQGTSSSRAIVFNRAGQIVASAQQEFPQHFPQPGWVEHDPFDIWNSQLATCRA
ALEQAKLTAADMAALGITNQRETTVVWERATGRPIFNAIVWQDRRTEAICERLRADGLED
TVRERTGLVIDPYFSGTKLRWILDHVDGARERAVRGELAFGTIDSWLVWQLTRGRLHVTD
VSNASRTLLWNIHTGQWDADLMRALDIHPSLLPEVHPSAHRFGQTDADWLGAPLTIGGIA
GDQQSALFGQACFKPGMAKNTYGTGCFMLLNTGERAVESRNGLISTAACQSGTRRSYALE
GSVFVGGAVVQWLRDGLRAIQRSADVEGLAASVPDSGGVVFVPSFTGLGAPYWDPTAQGA
IVGLSRGTTIGHIARAALESIAFQSTALLQAMTRDAVSAISELRVDGGASANNLLLQFQA
DLLGIPVVRPEIIETTALGAAYLAGIATGFYRGEDEVAQQWRASRTFHPVISRDEAQHRM
AQWEMAVAQVRLPTTHGH