Protein Info for RPSI07_RS09520 in Ralstonia solanacearum PSI07

Annotation: type II secretion system protein GspD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 805 signal peptide" amino acids 1 to 39 (39 residues), see Phobius details PF21305: type_II_gspD_N0" amino acids 57 to 126 (70 residues), 94.1 bits, see alignment E=5.4e-31 TIGR02517: type II secretion system protein D" amino acids 57 to 708 (652 residues), 646.3 bits, see alignment E=2.4e-198 PF03958: Secretin_N" amino acids 154 to 214 (61 residues), 57.8 bits, see alignment 1.6e-19 amino acids 217 to 296 (80 residues), 53.3 bits, see alignment E=4e-18 amino acids 303 to 433 (131 residues), 50.8 bits, see alignment E=2.4e-17 PF00263: Secretin" amino acids 534 to 701 (168 residues), 176.3 bits, see alignment E=6.2e-56

Best Hits

KEGG orthology group: K02453, general secretion pathway protein D (inferred from 100% identity to rsl:RPSI07_0373)

Predicted SEED Role

"General secretion pathway protein D"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (805 amino acids)

>RPSI07_RS09520 type II secretion system protein GspD (Ralstonia solanacearum PSI07)
MNDETMHNASSRHTVRAIVLACCATMVAGSLPAMPALAAPPASQAPAASNPGDEVSLNFV
NADLETVVKAVGQATGKNFIVDPRVKGTVNLVTEKPVTRAQALESLGSILRMQGYAIVEG
NGFTKVVPEADAKLQGSPTSVGPGAGRGGEQVVTQVFRLQYESANNLVPVLRPMIAPNNT
ITAYPANNTLVITDYADNLRRIARIIASIDSPAAGETELIPLKNAVAIDAAATLQKLLDP
SGTAGGAGAGAALADPSLRTSVVAEPRSNSVLVRASSAARMAQAKQLLAKLDVPGTRPGN
IWVVPLKNANAVQLATTLRAIVAADATLSASQSGGPGGQSAAQGAQAQQPATTGTQSGQN
TQTSSYGGGTSGSSGMGSGNSSFRASFGQSNLPATGGIIQADPATNALIITASEPVYRNL
RTVIDDLDARRAQVYIESMIVEVTSDKASQLGIQWMVGAGGPNTYGFGGTNFGSGVGNIL
NLGVIAATVGSGGIGSTAAQTALSGITGSNVSGLNGGNFGVFNKNTGLGAILSALGSDGS
VNVLSTPNLITLDNEEAKILIGQNVPITTGSYAQTGSAASVTPFQTFDRKDVGITLRVKP
QITDGGLVKMQIFQESSAVVNGTQNATQGPTTNVRSIETNVLANDGQVIVLGGLLEDNYQ
DAEQKVPGLGDIPVLGALFRSESKQRKKTNLLVFLRPYILRTAEATGALSDNRYNYMRDT
QQGFVSPNVLPTTSDRDTPVLPSPDSMRPAQSYGDVSVVPKGPTGVQVPPGAPMPQGTTR
SEPRLQNFAPPTSGGYDSNAPRNGG