Protein Info for RPSI07_RS09515 in Ralstonia solanacearum PSI07

Annotation: type II secretion system protein GspE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 518 TIGR02533: type II secretion system protein E" amino acids 22 to 516 (495 residues), 731.7 bits, see alignment E=1.9e-224 PF00437: T2SSE" amino acids 133 to 399 (267 residues), 355.3 bits, see alignment E=1.9e-110

Best Hits

KEGG orthology group: K02454, general secretion pathway protein E (inferred from 100% identity to rsl:RPSI07_0372)

Predicted SEED Role

"General secretion pathway protein E"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (518 amino acids)

>RPSI07_RS09515 type II secretion system protein GspE (Ralstonia solanacearum PSI07)
MATQAPTSDARTLEPPSPSAVRLVPYVFARDARLLVARQDVDTLEVWVCPETSRTALAEL
ARVFGALRLVSLDAAALSTATQTAYNAQDGSAAQVVGEVEGEVDLSRLMQDIPAVEDLLE
SEDDAPIIRMINALLTQAAREGASDIHIEPFENASVVRFRVDGTLRDVVRPKKALHGALI
SRIKIMAQLDIAEKRLPQDGRITLRVGGRPVDVRVSTLPTGHGERAVLRLLDKEAGRLDL
GKLGMGAGTLARFDHLINQPHGIVLVTGPTGSGKTTTLYAALSRLDAASTNIMTVEDPIE
YDLDGIGQTQVNPKIDMTFAKALRAILRQDPDVVMIGEIRDLETAQIAVQASLTGHLVLA
TLHTNDSASAVTRLIDMGIEPFLLSSSLLGVLAQRLVRRLCVHCRREEVLELTPTEIEAV
AGTPPVDGVTSAVPTRRSVWHHVGCEHCGHSGYQGRTGVYELLTVTSEIQTMIHRQAPES
EIKALAIGQGMHTMRADAQRWLDAGATSLEEVLRVTRD