Protein Info for RPSI07_RS09230 in Ralstonia solanacearum PSI07

Annotation: aminoacetone oxidase family FAD-binding enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 398 to 421 (24 residues), see Phobius details PF03486: HI0933_like" amino acids 10 to 413 (404 residues), 398.9 bits, see alignment E=6.8e-123 PF01494: FAD_binding_3" amino acids 10 to 41 (32 residues), 26.8 bits, see alignment (E = 9.2e-10) TIGR00275: flavoprotein, HI0933 family" amino acids 10 to 412 (403 residues), 286.9 bits, see alignment E=2.3e-89 PF13450: NAD_binding_8" amino acids 12 to 43 (32 residues), 26.1 bits, see alignment (E = 2.6e-09) TIGR03862: flavoprotein, TIGR03862 family" amino acids 30 to 419 (390 residues), 532.5 bits, see alignment E=5.1e-164

Best Hits

KEGG orthology group: K07007, (no description) (inferred from 100% identity to rsl:RPSI07_0296)

Predicted SEED Role

"NAD(FAD)-utilizing dehydrogenases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (426 amino acids)

>RPSI07_RS09230 aminoacetone oxidase family FAD-binding enzyme (Ralstonia solanacearum PSI07)
MSEPHNVPLVAVIGAGPAGLIAAEVLSRAGVRVEVFDSMPSAGRKFLLAGIGGMNITHSE
AFDAFLGRYRARREQLAPLIDRFSPDALRDWVHGLGIETFIGSSGRVFPTDMKAAPLLRA
WLHRLREAGVKLHMRHRWDGWSAAPSDQADQPEALRFETPDGERLVHADAVVLAMGGGSW
PRLGSDGAWVPRLEARGVQVLPLRPANCGFDADWSAHFRERFAGQPVKSVAIGIASGDDA
TRQFRQGEFLVTQSGIEGSLVYALSAPIRDALEAGGEITIWLDLAPGWSAQRVADALMRS
RGARSMSSHLQSRLNITGVKLGLLRECLSKDAFADLAQLAQAIKALPLRLTRARPIDEAI
SSAGGVAFEALDANLMIACLPGVFCAGEMLDWEAPTGGYLLTACFASGAAAGHGVLAYLA
TAAARG