Protein Info for RPSI07_RS08750 in Ralstonia solanacearum PSI07

Annotation: flavocytochrome C sulfide dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF07992: Pyr_redox_2" amino acids 36 to 154 (119 residues), 42.9 bits, see alignment E=6.5e-15 PF21706: FCSD_central" amino acids 169 to 283 (115 residues), 134.8 bits, see alignment E=2.3e-43 PF09242: FCSD-flav_bind" amino acids 361 to 427 (67 residues), 77.6 bits, see alignment E=1.1e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to rsl:RPSI07_0185)

Predicted SEED Role

"Sulfide dehydrogenase [flavocytochrome C] flavoprotein chain precursor (EC 1.8.2.-)" in subsystem Sulfur oxidation (EC 1.8.2.-)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (428 amino acids)

>RPSI07_RS08750 flavocytochrome C sulfide dehydrogenase (Ralstonia solanacearum PSI07)
MSLYRDRRAVLRAIGATALAGPLAACASLSGMRNARVVVVGGGYGGATAAKYVRVFSGGR
VDVTLVEPNAAFVSCPLSNLVLSGDRDLASLTVPYDALVERHGVRWVRDRAAAIDLGARQ
VRLAGGGTLDYDRLILSPGIDFVPGAIPGLADAATAARAPHAWKAGAQTLALRHRLEAMP
NGGVVTISIPLAPYRCPPAPYERACLIAHWLQHARPASRVLILDANDDVTSKGALFKRVW
AQRYPDHIEYRPQYNAVDIDAAGRVLKFDVQDDVEADVVNLIPPQRAGAIAVAAGLATAN
GRWCEVDFLTFESKVAPGVHVIGDAIQTAPLMPKSGHMANQHGKVAAAAVVAMLAGRAPD
PSPLYANTCYSFTAPDEAMHVATVHRYDAAEQTMVTVPGAGGLSDAPSVAEGNLAQGWSR
AIWSDMLG