Protein Info for RPSI07_RS08690 in Ralstonia solanacearum PSI07

Annotation: ureidoglycolate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 180 PF04115: Ureidogly_lyase" amino acids 13 to 168 (156 residues), 214.8 bits, see alignment E=2.8e-68

Best Hits

Swiss-Prot: 75% identical to ALLA_BURMS: Ureidoglycolate lyase (allA) from Burkholderia mallei (strain SAVP1)

KEGG orthology group: K01483, ureidoglycolate hydrolase [EC: 3.5.3.19] (inferred from 100% identity to rsl:RPSI07_0173)

MetaCyc: 50% identical to ureidoglycolate lyase (Escherichia coli K-12 substr. MG1655)
Ureidoglycolate lyase. [EC: 4.3.2.3]

Predicted SEED Role

"Ureidoglycolate hydrolase (EC 3.5.3.19)" in subsystem Allantoin Utilization (EC 3.5.3.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.3.19 or 4.3.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (180 amino acids)

>RPSI07_RS08690 ureidoglycolate lyase (Ralstonia solanacearum PSI07)
MSHDIATTEARTALLIEPLTREAFAPFGDVIELEGAQHFPINQGTTTRFHDLANVEVGEG
GRALINLFRGQPRALPFEVTMLERHPRGSQAFIPLNDRPYLVVVAPAGELDPTRLRAFVT
RGWQGVNYARGVWHHPLLALDAVSDFIVVDRGGEGPNCDEQDLPEPVWLTEAALRAAQQH