Protein Info for RPSI07_RS08290 in Ralstonia solanacearum PSI07

Annotation: lysoplasmalogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 transmembrane" amino acids 28 to 49 (22 residues), see Phobius details amino acids 61 to 78 (18 residues), see Phobius details amino acids 90 to 107 (18 residues), see Phobius details amino acids 113 to 133 (21 residues), see Phobius details amino acids 143 to 162 (20 residues), see Phobius details amino acids 168 to 189 (22 residues), see Phobius details amino acids 197 to 219 (23 residues), see Phobius details amino acids 225 to 243 (19 residues), see Phobius details PF07947: YhhN" amino acids 64 to 241 (178 residues), 153.6 bits, see alignment E=2.3e-49

Best Hits

KEGG orthology group: None (inferred from 100% identity to rsl:RPSI07_0092)

Predicted SEED Role

"POSSIBLE MEMBRANE PROTEIN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (258 amino acids)

>RPSI07_RS08290 lysoplasmalogenase (Ralstonia solanacearum PSI07)
MVEGHTTQPARAPEQRAGGYGMPARVRAWWVAAAVAGVTYGGMLTMVAVDVGPGTPLAGR
IVAQPLWKMLMALLLARAASRHEMQRERRWLVGALLFSALGDLLLALPGLRISFVAGLAS
FLFSHLCYLRVLVSLRGACSPLRLFGVGAVLGVAIGMLKWYWPGLGDLRGPVIAYVIVLS
AMVCAALLARLPGPLTAWGATAFAASDAMVGISVFVFPFNDHELAIWWSYAAAQLLITAG
LLTRRAPPPRRTLPAASA