Protein Info for RPSI07_RS08185 in Ralstonia solanacearum PSI07

Annotation: nitrate ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 PF00005: ABC_tran" amino acids 29 to 168 (140 residues), 118 bits, see alignment E=5.3e-38 PF09821: AAA_assoc_C" amino acids 304 to 421 (118 residues), 128.3 bits, see alignment E=2.3e-41

Best Hits

KEGG orthology group: K02049, sulfonate/nitrate/taurine transport system ATP-binding protein (inferred from 100% identity to rsl:RPSI07_0068)

Predicted SEED Role

"ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component" in subsystem Alkanesulfonate assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (450 amino acids)

>RPSI07_RS08185 nitrate ABC transporter ATP-binding protein (Ralstonia solanacearum PSI07)
MATNGEAVIELRGVSKIFRTADRTDRAVLEGVDLTLRQGEIVAMLGKSGSGKSTLLRIMA
GLVRADRGKVLFRGREYGGPVQGIAMVFQSFALFPWLTVQQNVELGLEAQGVPKAEREER
AEQAIDLIGLSGFNSALPRELSGGMRQRVGIARALVTEPDLLLMDEAFSALDVLTGENLR
DEMLDLWEDRRTNIKSILIVSHNIEEAVMMADRIVILSSDPGRIRAEVRVPFPRPRNRDS
SAVRNLIDEVYGLMTSPEQVGVRVGAPAAAQQLAYRLPEAEIGQMEAILDLLVEAPFNGR
ADLPHLAEEAGVTDDDLLPACEALALLQLATIERGDIIVTPFGKTYMETEPPERKVLFGQ
KLLERVALAAHIRTELDASEDGEIREEQVLRELEAYLKPEEAERVLKIGIEWGRYGEVYE
YVYNTGMLTLPREEREEREAEEGGGDGAAA