Protein Info for RPSI07_RS08165 in Ralstonia solanacearum PSI07

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details TIGR02001: conserved hypothetical protein" amino acids 22 to 271 (250 residues), 269.6 bits, see alignment E=1.3e-84 PF09694: Gcw_chp" amino acids 46 to 271 (226 residues), 235.1 bits, see alignment E=5.4e-74

Best Hits

KEGG orthology group: None (inferred from 100% identity to rsl:RPSI07_0062)

Predicted SEED Role

"PROBABLE SIGNAL PEPTIDE PROTEIN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (271 amino acids)

>RPSI07_RS08165 hypothetical protein (Ralstonia solanacearum PSI07)
MQAKQFPSRATIIGGVVFCAAVLNGALAHAQSADTAPAAVTTPAPALTANVTLASQYRYR
GIMQSNNKPAIQGGFDYAIPGGLLPEGFYVGNWNSSISWLSDANASVSAPIEMDFYGGYK
TEIVKDVPIDVGVLQYYYPGSYPEGFTRPHTTEGYAQIGYGPVTFKYSHAFSNLFGFADS
HHSQYFDLSGNFDTGFWGLTLNLHVGYQDVKHQNPRASYADWKIGVTKDFGSGWTASLAY
IDTNASRLTYTNSHGNYMGKATALLAVTKTF