Protein Info for RPSI07_RS08025 in Ralstonia solanacearum PSI07

Annotation: amino acid ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 17 to 165 (149 residues), 128 bits, E=4.3e-41

Best Hits

Swiss-Prot: 56% identical to GLNQ_BACSU: Glutamine transport ATP-binding protein GlnQ (glnQ) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to rsl:RPSI07_0033)

MetaCyc: 54% identical to L-glutamine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-12-RXN [EC: 7.4.2.1]

Predicted SEED Role

"Cell division transporter, ATP-binding protein FtsE (TC 3.A.5.1.1)" in subsystem Bacterial Cell Division (TC 3.A.5.1.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Protein Sequence (253 amino acids)

>RPSI07_RS08025 amino acid ABC transporter ATP-binding protein (Ralstonia solanacearum PSI07)
MIEIRDLQKHFGEHHVLRGVSLHVDKGEVVCLIGPSGSGKSTVLRCINGLESYDGGEIRA
FGERVDRDSKTIHTLRSRMGMVFQRFNLFPHRSVLENVMEGPVYVKGERPDAARAKAMTL
LEKVGLAAKAQAYPGQLSGGQQQRVAIARALAMEPEAMLFDEPTSALDPELVGDVLEVMR
ALAREGMTMIVVTHEMGFAREVADRVCFLHSGTIVEEGPAAQVLGAPRQPRTQDFLRRVL
HKPVEPATGDLAL